missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP109284

Invitrogen™ Human E4F1 Control Fragment Recombinant Protein

Numéro de catalogue. RP109284
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP109284 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109284 Fournisseur Invitrogen™ Code fournisseur RP109284

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139980 (PA5-139980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function as a transcriptional repressor. May also function as a ubiquitin ligase mediating ubiquitination of chromatin-associated TP53. Functions in cell survival and proliferation through control of the cell cycle. Functions in the p53 and pRB tumor suppressor pathways and regulates the cyclin CCNA2 transcription.; FUNCTION: Identified as a cellular target of the adenoviral oncoprotein E1A, it is required for both transcriptional activation and repression of viral genes.

Spécifications

Numéro d'enregistrement Q66K89
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 1877
Nom Human E4F1 Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène deoxyribonuclease 1-like 2; Dnase1l2; E4F; E4F transcription factor 1; E4F1; p120E4F; p50E4F; phi-AP3; putative E3 ubiquitin-protein ligase E4F1; RING-type E3 ubiquitin transferase E4F1; Transcription factor E4F; transcription factor E4F1; Transcription factor phi AP3
Nom usuel E4F1
Symbole de gène E4F1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence VGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats