missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98095

Invitrogen™ Human DISP2 (aa 209-317) Control Fragment Recombinant Protein

Catalog No. RP98095
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98095 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98095 Supplier Invitrogen™ Supplier No. RP98095
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63790 (PA5-63790. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DISP2, also known as dispatched homolog 2, is a protein that plays a critical role in the regulation of the hedgehog signaling pathway. It is involved in the transport and release of hedgehog ligands, which are important for cellular differentiation and tissue development. Mutations in the DISP2 gene have been associated with various developmental disorders, including holoprosencephaly and cleft lip and palate. DISP2 is also being studied as a potential therapeutic target in cancer, as the hedgehog pathway is frequently dysregulated in various types of tumors

Specifications

Accession Number A7MBM2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85455
Name Human DISP2 (aa 209-317) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI840597; B230210L08Rik; C15orf36; DISP2; dispatched B; dispatched homolog 2; dispatched homolog 2 (Drosophila); dispatched RND transporter family member 2; DISPB; HsT16908; KIAA1742; LINC00594; mKIAA1742; Protein dispatched homolog 2
Common Name DISP2
Gene Symbol DISP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DIGSKLVVWRALQALTGPRKLLFLSPDLELNSSSSHNTLRPAPRGSAQESAVRPRRMVEPLEDRRQENFFCGPPEKSYAKLVFMSTSSGSLWNLHAIHSMCRMEQDQIR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less