missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109418

Invitrogen™ Human DACT1 (aa 179-270) Control Fragment Recombinant Protein

Catalog No. RP109418
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109418 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109418 Supplier Invitrogen™ Supplier No. RP109418
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dapper homolog 1, an ortholog of Xenopus Dpr, antagonizes Wnt signaling by promoting Dvl degradation via a lysosome inhibitor-sensitive and proteasome inhibitor-insensitive mechanism. Dapper homolog 1 acts as an interacting protein for Dvl, and the interaction is formed between the DEP (Dishevelled, Egl-10, and pleckstrin) domain of Dvl and the central and C-terminal regions of Dapper homolog 1. The gene for human Dapper homolog 1 is localized on chromosomal region 14q23.1. The protein impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. The protein is also required for normal notochord formation and is downregulated in hepatocellular carcinomas (HCC). It is expressed in human liver and various other tissues.

Specifications

Accession Number Q9NYF0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51339
Name Human DACT1 (aa 179-270) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921528D17Rik; AI115603; dact1; dact1.S; dact1-a; dact1-b; DAPPER; dapper 1; dapper 1-A; dapper antagonist of catenin 1; Dapper homolog 1; dapper homolog 1, antagonist of beta-catenin; dapper homolog 1, antagonist of beta-catenin (xenopus); dapper, antagonist of beta-catenin; dapper, antagonist of beta-catenin, homolog 1; dapper1; dapper1b; dishevelled binding antagonist of beta catenin 1; dishevelled-binding antagonist of beta-catenin 1; dishevelled-binding antagonist of beta-catenin 1 S homeolog; dishevelled-interacting protein; dpr; dpr1; frd1; FRODO; frodo 1; frodo homolog; Frodo1; functional regulator of dsh in ontogenesis; HDPR1; Hepatocellular carcinoma novel gene 3 protein; heptacellular carcinoma novel gene 3; HNG3; MDpr1; MTNG3; RGD1564008; signaling protein; thye x 3; thymus expressed gene 3; thymus-expressed novel gene 3 protein; XDpr; XDpr1b; XELAEV_18041122mg
Common Name DACT1
Gene Symbol DACT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VFSECLSSCHSSTCFCSPLEATLSLSDGCPKSADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less