missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108196

Invitrogen™ Human CUBN (aa 691-839) Control Fragment Recombinant Protein

Numéro de catalogue. RP108196
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108196 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108196 Fournisseur Invitrogen™ Code fournisseur RP108196
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83684 (PA5-83684. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cubilin (CUBN) acts as a receptor for intrinsic factor-vitamin B12 complexes. The role of receptor is supported by the presence of 27 CUB domains. Cubulin is located within the epithelium of intestine and kidney. Mutations in CUBN may play a role in autosomal recessive megaloblastic anemia.

Spécifications

Accession Number O60494
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8029
Name Human CUBN (aa 691-839) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 460 kDa receptor; AA408369; AL022750; cubilin; cubilin (intrinsic factor-cobalamin receptor); cubilin precursor variant 1; cubilin precursor variant 2; cubilin precursor variant 3; CUBN; Cubulin; D2Wsu88e; Glycoprotein 280; GP280; IFCR; Intestinal intrinsic factor receptor; intrinsic factor-cobalamin receptor; Intrinsic factor-vitamin B12 receptor; MGA1
Common Name CUBN
Gene Symbol CUBN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDQGFHITYLTSPSDLRCGGNYTDPEGELFLPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats