missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108653

Invitrogen™ Human COL9A2 (aa 504-533) Control Fragment Recombinant Protein

Numéro de catalogue. RP108653
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108653 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108653 Fournisseur Invitrogen™ Code fournisseur RP108653
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84981 (PA5-84981. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia. [provided by RefSeq, Jul 2008].

Spécifications

Accession Number Q14055
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1298
Name Human COL9A2 (aa 504-533) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI427499; alpha 1 type IX collagen; alpha 2 type IX collagen; COL9A2; Col9a-2; Collagen alpha-2(IX) chain; collagen IX, alpha-2 polypeptide; collagen type IX alpha 2; collagen, type IX, alpha 2; DJ39G22.4; EDM2; MED; procollagen, type IX, alpha 2; STL5
Common Name COL9A2
Gene Symbol COL9A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGVPGQPGRQGVEGRDATDQHIVDVALKML
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats