missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP102056

Invitrogen™ Human CDK6 (aa 219-324) Control Fragment Recombinant Protein

Numéro de catalogue. RP102056
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP102056 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP102056 Fournisseur Invitrogen™ Code fournisseur RP102056

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK6 functions as a cell-cycle initiator protein. This protein is coexpressed and copurified with CyclinD1. They are critical regulators of cell cycle progression. The prototype member of this family, p34cdc2, and a related protein cdk2, function late in the cycle while cdk4 and cdk6 are critically involved in G1 to S progression. CDK6 is essential for cell proliferation within the dentate gyrus of the hippocampus and the cuventricular zone of the lateral ventricles. Mutations in the gene results in microcephaly 12, primary, autosomal recessive (MCPH12).

Spécifications

Numéro d'enregistrement Q00534
Concentration ≥5.0 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
ID du gène (Entrez) 1021
Nom Human CDK6 (aa 219-324) Control Fragment
Plage de pH 7.4
Méthode de purification Purified
Quantité 100 μL
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
Statut réglementaire RUO
Alias du gène 5830411I20; AI504062; CDK6; CDKN6; Cell division protein kinase 6; CR2 protein kinase; Crk2; cyclin dependent kinase 6; cyclin-dependent kinase 6; MCPH12; MGC59692; PLSTIRE; Serine/threonine-protein kinase PLSTIRE
Nom usuel CDK6
Symbole de gène CDK6
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats