missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CAMTA2 (aa 913-1022) Control Fragment Recombinant Protein

Numéro de catalogue. RP108774
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108774 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108774 Fournisseur Invitrogen™ Code fournisseur RP108774

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140051 (PA5-140051. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription activator. May act as tumor suppressor.

Spécifications

Accession Number O94983
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23125
Name Human CAMTA2 (aa 913-1022) Control Fragment
Quantity 100 μL
Gene Alias calmodulin binding transcription activator 2; calmodulin-binding transcription activator 2; Camta2; Kiaa0909; Kiaa0909-hp; mKIAA0909
Common Name CAMTA2
Gene Symbol CAMTA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats