missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP90574

Invitrogen™ Human C2orf66 (aa 40-117) Control Fragment Recombinant Protein

Numéro de catalogue. RP90574
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP90574 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP90574 Fournisseur Invitrogen™ Code fournisseur RP90574

Pour de l'aide SVP utiliser la function de clavardage; nous envoyer un couriel à help@thermofisher.com ou appelez le service à la clientèle au 1-800-234-7437.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (24%), Rat (24%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54269. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spécifications

Numéro d'enregistrement Q6UXQ4
Concentration ≥5.0 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
ID du gène (Entrez) 401027
Nom Human C2orf66 (aa 40-117) Control Fragment
Plage de pH 7.4
Méthode de purification Purified
Quantité 100 μL
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
Statut réglementaire RUO
Alias du gène C2orf66; chromosome 2 open reading frame 66; IIDS6411; uncharacterized protein C2orf66; UNQ6411; UNQ6411/PRO21186
Nom usuel C2orf66
Symbole de gène C2orf66
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence TVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats