missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108202

Invitrogen™ Human C13orf28 Control Fragment Recombinant Protein

Numéro de catalogue. RP108202
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108202 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108202 Fournisseur Invitrogen™ Code fournisseur RP108202
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83909 (PA5-83909. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPACA7 is a protein coding gene involved in fertilization. Seems not to play a direct role in sperm-egg binding or gamete fusion.

Spécifications

Accession Number Q96KW9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 122258
Name Human C13orf28 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C13orf28; protein SPACA7; SPACA7; sperm acrosome associated 7; sperm acrosome-associated protein 7
Common Name C13orf28
Gene Symbol SPACA7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats