missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP109780

Invitrogen™ Human Arfaptin 2 (aa 57-121) Control Fragment Recombinant Protein

Numéro de catalogue. RP109780
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109780 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109780 Fournisseur Invitrogen™ Code fournisseur RP109780

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144775 (PA5-144775. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in constitutive metalloproteinase (MMP) secretion from the trans Golgi network. May have important functions during vesicle biogenesis at certain cargo subdomains, which could be predominantly utilized by secreted MMPs, such as MMP7 and MMP2 (PubMed:26507660). Participates also in autophagy by regulating the starvation-depdendent trafficking of ATG9A vesicles which deliver the PI4-kinase to the autophagosome initiation site (PubMed:31204568). In addition, plays a role in NF-kappa-B inhibition by interacting with IKBKB and IKBKG (PubMed:26296658). [UniProt]

Spécifications

Accession Number P53365
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23647
Name Human Arfaptin 2 (aa 57-121) Control Fragment
Quantity 100 μL
Gene Alias 2310002N04Rik; ADP ribosylation factor interacting protein 2; ADP-ribosylation factor interacting protein 2; ADP-ribosylation factor interacting protein 2 (arfaptin 2); ADP-ribosylation factor-interacting protein 2; Arfaptin 2; arfaptin-2; Arfip2; Partner of RAC1; partner of RAC1 (arfaptin 2); POR; POR1; Protein POR1
Common Name Arfaptin 2
Gene Symbol ARFIP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats