missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP91109

Invitrogen™ Human Aquaporin 4 (aa 253-323) Control Fragment Recombinant Protein

Numéro de catalogue. RP91109
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP91109 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP91109 Fournisseur Invitrogen™ Code fournisseur RP91109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53234 (PA5-53234. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In skeletal muscle, AQP4 (aquaporin 4 also known as mercurial insensitive water channel), localizes to the sarcolemma of fast-twitch muscle fibers. Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. Many isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP10. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7, AQP9 and one of the two AQP10 transcripts are also permeable to urea and glycerol.

Spécifications

Numéro d'enregistrement P55087
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 361
Nom Human Aquaporin 4 (aa 253-323) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène Aqp4; AQP-4; aquaporin 4; aquaporin type4; Aquaporin4; aquaporin-4; HMIWC2; Mercurial-insensitive water channel; MGC22454; MIWC; MIWC2; WCH4
Nom usuel Aquaporin 4
Symbole de gène AQP4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats