missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP105414

Invitrogen™ Human ANKMY2 (aa 1-92) Control Fragment Recombinant Protein

Numéro de catalogue. RP105414
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP105414 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP105414 Fournisseur Invitrogen™ Code fournisseur RP105414
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66894 (PA5-66894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ANKMY2 (ankyrin repeat and MYND domain containing 2) is a 441 amino acid protein that contains three ANK repeats and one MYND-type zinc finger. Encoded by a gene that maps to human chromosome 7p21.1, ANKMY2 is conserved in chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito and Caenorhabditis elegans. Downregulation of ANKMY2, associated with frequent deletions of human chromosome 7p22.1, indicate that ANKMY2 may role a role in the pathogenesis of natural killer (NK)-cell malignancies. ANKMY2 is also upregulated by enforced expression of Hox11, which functions broadly to hinder hemopoiesis, diverts differentiation to an alternative fate and promotes pre-leukaemic states.

Spécifications

Accession Number Q8IV38
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57037
Name Human ANKMY2 (aa 1-92) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI035571; ANKMY2; ankyrin repeat and MYND domain containing 2; ankyrin repeat and MYND domain-containing protein 2; EGK_13887; Gna14; guanine nucleotide binding protein, alpha 14; LOW QUALITY PROTEIN: ankyrin repeat and MYND domain-containing protein 2; ZMYND20
Common Name ANKMY2
Gene Symbol Ankmy2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats