missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAMTS4 (aa 104-195) Control Fragment Recombinant Protein

Numéro de catalogue. RP106333
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP106333 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP106333 Fournisseur Invitrogen™ Code fournisseur RP106333
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

Spécifications

Accession Number O75173
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9507
Name Human ADAMTS4 (aa 104-195) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3830423K05; a disintegrin and metallopeptidase with thrombospondin motifs 4; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 4; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 4; ADAM metallopeptidase with thrombospondin type 1 motif, 4; ADAMs; ADAM-TS 4; ADAMTS family member; ADAMTS-2; Adamts4; ADAM-TS4; ADAMTS-4; ADMP-1; Aggrecanase; Aggrecanase 1; aggrecanase-1; disintegrin and metalloproteinase with thrombospondin motifs 2; KIAA0688; metalloendopeptidases; metalloproteinase; mKIAA0688; UNQ769/PRO1563
Common Name ADAMTS4
Gene Symbol ADAMTS4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats