missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. PIPA578806

Invitrogen™ Aquaporin 1 Polyclonal Antibody
GREENER_CHOICE

Numéro de catalogue. PIPA578806
Modifier l'affichage
Click to view available options
Quantité:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
PIPA578806 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. PIPA578806 Fournisseur Invitrogen™ Code fournisseur PA578806

Pour de l'aide SVP utiliser la function de clavardage; nous envoyer un couriel à help@thermofisher.com ou appelez le service à la clientèle au 1-800-234-7437.

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Spécifications

Antigène Aquaporin 1
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugué Unconjugated
Formule PBS with 4mg trehalose and no preservative
Gène Aqp1
Numéro d’acquisition du gène P29972, P29975, Q02013
Alias du gène AQP 1; AQP CHIP; Aqp1; AQP-1; AQP-CHIP; aquaporin 1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1 (Colton blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin1; aquaporin-1; Aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP 28; CHIP28; CO; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; membrane channel; MGC26324; urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Symboles de gène Aqp1
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
Méthode de purification Antigen affinity chromatography
Quantité 100 μg
Statut réglementaire RUO
Primaire ou secondaire Primary
ID du gène (Entrez) 11826, 25240, 358
Espèces cibles Human, Mouse, Rat
Contenu et stockage -20°C
Type de produit Antibody
Forme Lyophilized
Isotype IgG
Afficher plus de résultats Afficher moins de résultats