nuclear receptor 2C2-associated protein, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TRA16.

Supplier: Abnova Corporation H00126382A01

Numéro de catalogue. 89004777

Quantité

Description

Sequence: NSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV

Spécifications

Antigen	nuclear receptor 2C2-associated protein
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant TRA16.
Gene	NR2C2AP
Gene Alias	TRA16
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	126382
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_176880
Gene Symbols	NR2C2AP
Immunogen	TRA16 (NP_795361, 40 a.a. ∼ 139 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

missing translation for 'recommendations'

Description