TFB2M, Mouse, Clone: 2E10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TFB2M.

Supplier: Abnova Corporation H00064216M01

Numéro de catalogue. 89-002-651

Quantité

Description

Sequence: YLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

Spécifications

Antigen	TFB2M
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_022366
Gene Symbols	TFB2M
Immunogen	TFB2M (NP_071761, 297 a.a. ∼ 396 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Applications	ELISA, Western Blot
Clone	2E10
Description	Mouse monoclonal antibody raised against a partial recombinant TFB2M.
Gene	TFB2M
Gene Alias	FLJ22661/FLJ23182/Hkp1
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	64216
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

missing translation for 'recommendations'

Description