missing translation for 'onlineSavingsMsg'
Learn More

eukaryotic translation initiation factor 3, subunit H, Mouse, Clone: 3B12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EIF3S3.

Supplier: Abnova Corporation H00008667M01

Catalog No. 89001096

Quantity

Description

Sequence: YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRV

Specifications

Antigen	eukaryotic translation initiation factor 3, subunit H
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_003756
Gene Symbols	EIF3H
Immunogen	EIF3S3 (NP_003747, 152 a.a. ∼ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	8667
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Applications	ELISA, Western Blot
Clone	3B12
Description	Mouse monoclonal antibody raised against a partial recombinant EIF3S3.
Gene	EIF3H
Gene Alias	EIF3S3/MGC102958/eIF3-gamma/eIF3-p40
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Product Suggestions

Description