missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004741

chromosome 1 open reading frame 57 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Numéro de catalogue. 89004741
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
89004741 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. 89004741 Fournisseur Abnova Corporation Code fournisseur H00084284A01
Il en reste null

Description

Mouse polyclonal antibody raised against a partial recombinant C1orf57.

Sequence: LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK

Spécifications

Antigen chromosome 1 open reading frame 57
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant C1orf57.
Formulation 50% glycerol
Gene C1orf57
Gene Accession No. NM_032324
Gene Alias FLJ11383/MGC13186/RP4-678E16.2
Gene Symbols C1orf57
Host Species Mouse
Immunogen C1orf57 (NP_115700, 91 a.a. ∼ 190 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 84284
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Afficher plus de résultats Afficher moins de résultats