missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Villin Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier: Invitrogen™ PA580221

Catalog No. PIPA580221

$800.81 / Each

Quantity

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Intestine Tissue, Mouse Kidney Tissue, RH35 whole cell, HEPG2 whole cell, MCF-7 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. Flow: CACO-2 cell.

Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.

Specifications

Chemical Identifiers

Antigen	Villin
Content And Storage	-20°C
Classification	Polyclonal
Form	Lyophilized
Isotype	IgG
Target Species	Human, Mouse, Rat
Gene	VIL1
Gene Alias	D2S1471; OTTHUMP00000207159; Vil; Vil1; villin 1; villin-1
Gene Symbols	VIL1
Primary or Secondary	Primary
Purification Method	Antigen affinity chromatography

Concentration	500 μg/mL
Applications	Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Gene Accession No.	P09327, Q62468
Gene ID (Entrez)	22349, 316521, 7429
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
Product Type	Antibody

Specifications

Antigen	Villin
Classification	Polyclonal
Conjugate	Unconjugated
Gene	VIL1
Gene Alias	D2S1471; OTTHUMP00000207159; Vil; Vil1; villin 1; villin-1
Host Species	Rabbit
Purification Method	Antigen affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	22349, 316521, 7429
Content And Storage	-20°C
Form	Lyophilized

Applications	Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Concentration	500 μg/mL
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Gene Accession No.	P09327, Q62468
Gene Symbols	VIL1
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody
Isotype	IgG

Product Suggestions

Invitrogen™ Villin Polyclonal Antibody

Description

Chemical Identifiers

Specifications

Product Suggestions

Documents

Promotions