missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580221

Invitrogen™ Villin Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580221
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580221 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580221 Supplier Invitrogen™ Supplier No. PA580221
Only null left

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Intestine Tissue, Mouse Kidney Tissue, RH35 whole cell, HEPG2 whole cell, MCF-7 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. Flow: CACO-2 cell.

Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.

Specifications

Antigen Villin
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene VIL1
Gene Accession No. P09327, Q62468
Gene Alias D2S1471; OTTHUMP00000207159; Vil; Vil1; villin 1; villin-1
Gene Symbols VIL1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22349, 316521, 7429
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less