Learn More
Invitrogen™ UHRF2 Monoclonal Antibody (6B5)
Mouse Monoclonal Antibody
Supplier: Invitrogen™ MA549293
Description
Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is identical to the related mouse and rat sequences. Positive Control - WB: human HepG2 whole cell, human HT1080 whole cell, human Jurkat whole cell. ICC/IF: Hela cell. Flow: Hela cell, RH35 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.Specifications
| UHRF2 | |
| Monoclonal | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| Q96PU4 | |
| UHRF2 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN). | |
| 100 μg | |
| Primary | |
| Human, Rat | |
| Antibody | |
| IgG2b |
| Flow Cytometry, Western Blot, Immunocytochemistry | |
| 6B5 | |
| Unconjugated | |
| UHRF2 | |
| 2310065A22Rik; AI426270; AW214556; D130071B19Rik; E3 ubiquitin-protein ligase UHRF2; Nirf; np95/ICBP90-like RING finger protein; Np95-like ring finger protein; Nuclear protein 97; nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; RNF107; RP11-472F14.2; TDRD23; ubiquitin like with PHD and ring finger domains 2; ubiquitin-like PHD and RING finger domain-containing protein 2; ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase; ubiquitin-like, containing PHD and RING finger domains 2; ubiquitin-like, containing PHD and RING finger domains, 2; ubiquitin-like-containing PHD and RING finger domains protein 2; UHRF2; URF2 | |
| Mouse | |
| Antigen affinity chromatography | |
| RUO | |
| 115426, 309331 | |
| -20°C | |
| Lyophilized |