missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SULF2 (Human) Recombinant Protein
Human SULF2 full-length ORF ( AAH20962, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
Supplier: Abnova™ H00055959P012
Description
- Sequence: MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG
Specifications
| AAH20962 | |
| sulfatase 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SULF2 | |
| GST |
| 55959 | |
| Wheat germ expression system | |
| 2 μg | |
| DKFZp313E091, FLJ90554, HSULF-2, KIAA1247, MGC126411 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |