missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580050

Invitrogen™ SOD3 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580050
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580050 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580050 Supplier Invitrogen™ Supplier No. PA580050
Only null left

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human PC-3 whole cell. IHC: human lung cancer tissue, human mammary cancer tissue. ICC/IF: PC-3 cell.

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Specifications

Antigen SOD3
Applications Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene SOD3
Gene Accession No. P08294
Gene Alias AI314465; ALS; ALS1; EC SOD; EC-SOD; ECSODPT; extracellular superoxide dismutase; extracellular superoxide dismutase [Cu-Zn]; MGC20077; SOD 3; SOD3; Sod-3; Superoxide dimutase 3; superoxide dismutase; superoxide dismutase 3; superoxide dismutase 3, extracellular; superoxide dismutase B; testicular tissue protein Li 175
Gene Symbols SOD3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6649
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less