missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SLC25A27 (Human) Recombinant Protein
Human SLC25A27 full-length ORF ( AAH33091, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
Supplier: Abnova™ H00009481P012
Description
- Sequence: MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ
Specifications
| AAH33091 | |
| solute carrier family 25, member 27 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SLC25A27 | |
| GST |
| 9481 | |
| Wheat germ expression system | |
| 2 μg | |
| FLJ33552, UCP4 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |