missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. R&D Systems™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

R&D Systems™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Catalog No. NB254789100
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB254789100 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB254789100 Supplier R&D Systems™ Supplier No. NBP254789100UG

Please call Customer Service at 1-800-234-7437 or send an email to help@thermofisher.com for assistance.

Description

A Novus product, part of R&D Systems. Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Specifications

For Use With (Application) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formulation PBS
Gene ID (Entrez) 6622
Name Human alpha-Synuclein Aggregate Protein
Purification Method >95% pure by SDS-PAGE
Quantity 100 μg
Source E.Coli
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Storage Requirements Store at −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Gene Alias alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Gene Symbol SNCA
Biological Activity Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Product Type Recombinant Protein
Conjugate Unconjugated
Cross Reactivity Human
Recombinant Recombinant
Product Line Novus
Show More Show Less