missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106485

Invitrogen™ Human ZZZ3 (aa 808-902) Control Fragment Recombinant Protein

Catalog No. RP106485
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106485 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106485 Supplier Invitrogen™ Supplier No. RP106485

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65811 (PA5-65811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Specifications

Accession Number Q8IYH5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26009
Name Human ZZZ3 (aa 808-902) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110065C23Rik; 6430567E01Rik; AA408566; AI481057; ATAC component 1 homolog; ATAC1; AW556059; DKFZP564I052; R75514; RGD1565468; zinc finger ZZ-type containing 3; zinc finger, ZZ domain containing 3; zinc finger, ZZ-type containing 3; ZZ-type zinc finger-containing protein 3; Zzz3
Common Name ZZZ3
Gene Symbol ZZZ3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYLDPNYFPAN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less