missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95031

Invitrogen™ Human ZSCAN23 (aa 111-177) Control Fragment Recombinant Protein

Catalog No. RP95031
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95031 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95031 Supplier Invitrogen™ Supplier No. RP95031
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57483 (PA5-57483. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in transcriptional regulation.

Specifications

Accession Number Q3MJ62
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 222696
Name Human ZSCAN23 (aa 111-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dJ29K1.3; dJ29K1.3.1; zinc finger and SCAN domain containing 23; zinc finger and SCAN domain-containing protein 23; Zinc finger protein 390; zinc finger protein 453; ZNF390; ZNF453; ZSCAN23
Common Name ZSCAN23
Gene Symbol ZSCAN23
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HRPVSGEEAVTVLEDLERELDDPGEQVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQLGYNLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less