missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105254

Invitrogen™ Human ZNF9 (aa 28-61) Control Fragment Recombinant Protein

Catalog No. RP105254
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105254 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105254 Supplier Invitrogen™ Supplier No. RP105254

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66556 (PA5-66556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number P62633
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7555
Name Human ZNF9 (aa 28-61) Control Fragment
Quantity 100 μL
Gene Alias AA408710; CCHC-type zinc finger nucleic acid binding protein; CCHC-type zinc finger, nucleic acid binding protein; cellular nucleic acid binding protein; cellular nucleic acid binding protein 1; cellular nucleic acid-binding protein; CNBP; CNBP1; DM2; erythroid differentiation-related; HGNC:13164; PROMM; RNF163; sterol regulatory element-binding protein; ZCCHC22; zinc finger protein 273; zinc finger protein 9; zinc finger protein 9 (a cellular retroviral nucleic acid binding protein); Znf9
Common Name ZNF9
Gene Symbol CNBP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less