missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91315

Invitrogen™ Human ZNF643 (aa 152-274) Control Fragment Recombinant Protein

Catalog No. RP91315
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91315 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91315 Supplier Invitrogen™ Supplier No. RP91315
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60667 (PA5-60667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in transcriptional regulation. Essential for Golgi structural integrity (PubMed:29851555). [UniProt]

Specifications

Accession Number Q9UJL9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 65243
Name Human ZNF643 (aa 152-274) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias novel zinc finger protein; ZFP69 zinc finger protein B; ZFP69B; Zinc finger protein 643; Zinc finger protein 69 homolog B; zinc finger protein ZFP69B; ZKSCAN23B; ZNF643; ZSCAN54B
Common Name ZNF643
Gene Symbol ZFP69B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less