missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96941

Invitrogen™ Human ZNF622 (aa 108-194) Control Fragment Recombinant Protein

Catalog No. RP96941
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96941 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96941 Supplier Invitrogen™ Supplier No. RP96941
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57699 (PA5-57699. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF622 may behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.

Specifications

Accession Number Q969S3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90441
Name Human ZNF622 (aa 108-194) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110033B05Rik; D15Ertd806e; liver regeneration-related protein LRRG121; Zfp622; Zinc finger protein 622; zinc finger-like protein 9; Znf622; ZPR9
Common Name ZNF622
Gene Symbol ZNF622
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less