Learn More
Invitrogen™ Human ZNF432 (aa 149-201) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100010
Description
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111346 (PA5-111346, PA5-63830 (PA5-63830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZNF432 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF432 may be involved in transcriptional regulation.Specifications
| O94892 | |
| Blocking Assay, Control | |
| 9668 | |
| 100 μL | |
| KIAA0798; Zinc finger protein 432; ZNF432 | |
| ZNF432 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZNF432 (aa 149-201) Control Fragment | |
| RUO | |
| ZNF432 | |
| Unconjugated | |
| Recombinant | |
| SCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |