missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101469

Invitrogen™ Human ZNF35 (aa 113-211) Control Fragment Recombinant Protein

Catalog No. RP101469
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101469 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101469 Supplier Invitrogen™ Supplier No. RP101469

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62503 (PA5-62503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF35 is a new candidate transcription factor.

Specifications

Accession Number P13682
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7584
Name Human ZNF35 (aa 113-211) Control Fragment
Quantity 100 μL
Gene Alias HF0.10; HF10; mszf13; mszf20-1; mszf28; mszf68; Zfp105; Zfp239; Zfp35; Zfp-35; zinc finger protein 239; zinc finger protein 271; Zinc finger protein 35; zinc finger protein 35 (clone HF0.10); zinc finger protein HF0.10; Znf271; ZNF35
Common Name ZNF35
Gene Symbol ZNF35
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GAETKNLQLLVPKTEICEEAEKPLIISERIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSGGKYSLNSGAVK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less