missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZNF296 (aa 1-58) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104874
Description
Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65567 (PA5-65567. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be a transcriptional corepressor with KLF4.Specifications
| Q8WUU4 | |
| Blocking Assay, Control | |
| 162979 | |
| 100 μL | |
| ZFP296; zinc finger protein 296; Zinc finger protein 342; Znf296; ZNF342 | |
| ZNF296 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZNF296 (aa 1-58) Control Fragment | |
| RUO | |
| ZNF296 | |
| Unconjugated | |
| Recombinant | |
| MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |