missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99745

Invitrogen™ Human ZNF192 (aa 111-224) Control Fragment Recombinant Protein

Catalog No. RP99745
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99745 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99745 Supplier Invitrogen™ Supplier No. RP99745
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51942 (PA5-51942. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in transcriptional regulation. [UniProt]

Specifications

Accession Number Q15776
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7745
Name Human ZNF192 (aa 111-224) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510038J07Rik; CAML; D430019P06Rik; LD5-1; Zfp192; zinc finger protein 192; Zinc finger protein with KRAB and SCAN domains 8; zinc finger with KRAB and SCAN domains 8; ZKSCAN8; ZNF192; ZSCAN40
Common Name ZNF192
Gene Symbol ZKSCAN8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less