missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89371

Invitrogen™ Human ZNF18 (aa 130-263) Control Fragment Recombinant Protein

Catalog No. RP89371
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89371 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89371 Supplier Invitrogen™ Supplier No. RP89371

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52259 (PA5-52259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF18 be involved in transcriptional regulation.

Specifications

Accession Number P17022
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7566
Name Human ZNF18 (aa 130-263) Control Fragment
Quantity 100 μL
Gene Alias 1700128E15Rik; D11Ertd714e; HDSG1; Heart development-specific gene 1 protein; KO x 11; Zfp18; Zfp535; Zinc finger protein 18; zinc finger protein 18 (KOX 11); zinc finger protein 535; Zinc finger protein KO x 11; Zinc finger protein with KRAB and SCAN domains 6; zinc finger with KRAB and SCAN domains 6; Zkscan6; Znf18; ZNF535; ZSCAN38
Common Name ZNF18
Gene Symbol ZNF18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLSHIVKEESDTEAELALAASQPARLEERLIRDQDLGASLLPAAPQEQWRQLDSTQKEQYWDLMLETYGKMVSGAGISHPKSDLTNS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less