missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZNF143 (aa 148-233) Control Fragment Recombinant Protein

Catalog No. RP108020
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108020 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108020 Supplier Invitrogen™ Supplier No. RP108020

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67364. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional activator. Activates the gene for selenocysteine tRNA (tRNAsec). Binds to the SPH motif of small nuclear RNA (snRNA) gene promoters. Participates in efficient U6 RNA polymerase III transcription via its interaction with CHD8.

Specifications

Accession Number P52747
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7702
Name Human ZNF143 (aa 148-233) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AA959806; AU015869; D7Ertd805e; hStaf; KRAB14; mStaf; pHZ-1; SBF; selenocysteine tRNA activating factor; selenocysteine tRNA gene transcription activating factor; selenocysteine tRNA gene transcription-activating factor; si:dkey-8l13.2; SPH-binding factor; staf; transcriptional activator Staf; Zfp143; zfp-143; Zfp79; Zfp80-rs1; zgc:66276; zinc finger protein 143; zinc finger protein 143b; zinc finger protein 80, related sequence 1; znf143; znf143b
Common Name ZNF143
Gene Symbol ZNF143
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQEKKMQIVLQGHATRVTAKSQQSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less