missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZIP11 (aa 222-264) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105749
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64987 (PA5-64987. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ZIP11, also known as Slc39A11, is a member of the broader ZIP family of multi-transmembrane domain metal ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. Members of the ZIP family generally transport metal ions from the cell exterior or lumen of intracellular organelles into the cytoplasm, as opposed to the ZnT (SLC30) family of zinc transporters that serve to reduce intracellular zinc availability by promoting zinc efflux from cells or into intracellular vesicles. At least three isoforms of ZIP11 are known to exist.Specifications
| Q8N1S5 | |
| Blocking Assay, Control | |
| 201266 | |
| 100 μL | |
| 1810074D23Rik; C17orf26; SLC39A11; solute carrier family 39 (metal ion transporter), member 11; solute carrier family 39 member 11; solute carrier family 39, member 11; zinc transporter ZIP11; ZIP11; ZIP-11; Zrt- and Irt-like protein 11 | |
| SLC39A11 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZIP11 (aa 222-264) Control Fragment | |
| RUO | |
| ZIP11 | |
| Unconjugated | |
| Recombinant | |
| TASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |