missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92808

Invitrogen™ Human ZFAND2A (aa 68-145) Control Fragment Recombinant Protein

Catalog No. RP92808
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92808 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92808 Supplier Invitrogen™ Supplier No. RP92808
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53995 (PA5-53995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFAND2A (AN1-type zinc finger protein 2A) is a 171 amino acid protein containing two AN1-type zinc fingers. AN1-type zinc fingers contain six conserved cysteines, two histidines and have a dimetal (zinc)-bound alpha/beta fold. The gene encoding ZFAND2A maps to human chromosome 7, which houses over 1,000 genes and comprises nearly 5% of the human genome.

Specifications

Accession Number Q8N6M9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90637
Name Human ZFAND2A (aa 68-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AIRAP; AN1-type zinc finger protein 2 A; arsenite inducible RNA associated protein; ZFAND2A; zinc finger AN1-type containing 2 A; zinc finger, AN1-type domain 2 A
Common Name ZFAND2A
Gene Symbol ZFAND2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less