missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105282

Invitrogen™ Human ZDHHC14 (aa 308-369) Control Fragment Recombinant Protein

Catalog No. RP105282
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105282 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105282 Supplier Invitrogen™ Supplier No. RP105282

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66630 (PA5-66630. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZDHHC14 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include integral component of membrane; protein-cysteine S-palmitoyltransferase activity.

Specifications

Accession Number Q8IZN3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79683
Name Human ZDHHC14 (aa 308-369) Control Fragment
Quantity 100 μL
Gene Alias B530001K09Rik; Dhhc14; DHHC-14; membrane-associated DHHC14 zinc finger protein; NEW1 domain containing protein; NEW1 domain-containing protein; NEW1CP; probable palmitoyltransferase ZDHHC14; probable palmitoyltransferase ZDHHC14; LOW QUALITY PROTEIN: probable palmitoyltransferase ZDHHC14; si:ch211-199l3.1; ZDHHC14; Zinc finger DHHC domain-containing protein 14; zinc finger DHHC-type containing 14; zinc finger DHHC-type palmitoyltransferase 14; zinc finger, DHHC domain containing 14; zinc finger, DHHC-type containing 14
Common Name ZDHHC14
Gene Symbol ZDHHC14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less