missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZCCHC5 (aa 210-294) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100076
Description
Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62752 (PA5-62752. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May function as a transcriptional regulator. Plays a role in postnatal myogenesis, may be involved in the regulation of satellite cells self-renewal. {ECO:0000250 UniProtKB:Q6P1Y1}.Specifications
| Q8N8U3 | |
| Blocking Assay, Control | |
| 203430 | |
| 100 μL | |
| 3-Mar; D430021I08Rik; Gm375; mammalian retrotransposon-derived 3; Mar3; MART3; Retrotransposon Gag-like protein 3; Rtl3; Zcchc5; ZHC5; Zinc finger CCHC domain-containing protein 5; zinc finger CCHC-type containing 5; zinc finger, CCHC domain containing 5 | |
| RTL3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZCCHC5 (aa 210-294) Control Fragment | |
| RUO | |
| ZCCHC5 | |
| Unconjugated | |
| Recombinant | |
| LEGLIVVETSAASEFPQAPIGLEATDFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |