missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP100076

Invitrogen™ Human ZCCHC5 (aa 210-294) Control Fragment Recombinant Protein

Numéro de catalogue. RP100076
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP100076 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP100076 Fournisseur Invitrogen™ Code fournisseur RP100076

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62752 (PA5-62752. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May function as a transcriptional regulator. Plays a role in postnatal myogenesis, may be involved in the regulation of satellite cells self-renewal. {ECO:0000250 UniProtKB:Q6P1Y1}.

Spécifications

Accession Number Q8N8U3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 203430
Name Human ZCCHC5 (aa 210-294) Control Fragment
Quantity 100 μL
Gene Alias 3-Mar; D430021I08Rik; Gm375; mammalian retrotransposon-derived 3; Mar3; MART3; Retrotransposon Gag-like protein 3; Rtl3; Zcchc5; ZHC5; Zinc finger CCHC domain-containing protein 5; zinc finger CCHC-type containing 5; zinc finger, CCHC domain containing 5
Common Name ZCCHC5
Gene Symbol RTL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEGLIVVETSAASEFPQAPIGLEATDFPLQYTLTFSGDSQKLPEFLVQLYSYMRVRGHLYPTEAALVSFVGNCFSGRAGWWFQLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats