missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104189

Invitrogen™ Human ZC3H12C (aa 604-701) Control Fragment Recombinant Protein

Catalog No. RP104189
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104189 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104189 Supplier Invitrogen™ Supplier No. RP104189

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58557 (PA5-58557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H12C, also known as MCPIP3, is a member of a family of novel CCCH-zinc finger proteins that includes ZC3H12A, a protein that is thought to be involved in macrophage activation, host immunity and inflammatory diseases. Similar to ZC3H12A, ZC3H12C expression in macrophages is highly increased after treatment with lipopolysaccharide (LPS), suggesting it also may play a role in host immunity and inflammatory response.

Specifications

Accession Number Q9C0D7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85463
Name Human ZC3H12C (aa 604-701) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230108E06; C230027N18Rik; Kiaa1726; MCP induced protein 3; MCP-induced protein 3; MCPIP3; mKIAA1726; Probable ribonuclease ZC3H12C; RGD1565078; ZC3H12C; Zinc finger CCCH domain-containing protein 12 C; zinc finger CCCH type containing 12 C; zinc finger CCCH-type containing 12 C
Common Name ZC3H12C
Gene Symbol ZC3H12C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less