missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106107

Invitrogen™ Human XPB (aa 157-263) Control Fragment Recombinant Protein

Catalog No. RP106107
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106107 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106107 Supplier Invitrogen™ Supplier No. RP106107
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65423 (PA5-65423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human XPB DNA helicase is a subunit of the DNA repair/basal transcription factor TFIIH, and is involved in early steps of the nucleotide excision repair (NER) pathway. Two distinct clinical phenotypes, xeroderma pigmentosum associated with Cockayne's syndrome (XP/CS) and trichothiodystrophy (TTD), can be due to mutations in the XPB gene.

Specifications

Accession Number P19447
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2071
Name Human XPB (aa 157-263) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Basic transcription factor 2 89 kDa subunit; BTF2; BTF2 p89; BTF2-p89; DNA excision repair protein ERCC-3; DNA repair helicase; DNA repair protein complementing XP-B cells; ERCC excision repair 3, TFIIH core complex helicase subunit; Ercc3; Ercc-3; excision repair 3; excision repair cross-complementation group 3; excision repair cross-complementing rodent repair deficiency, complementation group 3; General transcription and DNA repair factor IIH helicase subunit XPB; GTF2H; RAD25; TFIIH; TFIIH 89 kDa subunit; TFIIH basal transcription factor complex 89 kDa subunit; TFIIH basal transcription factor complex helicase XPB subunit; TFIIH p89; TFIIH subunit XPB; TTD2; Xeroderma pigmentosum group B-complementing protein; xeroderma pigmentosum, complementation group B; XPB; XPBC
Common Name XPB
Gene Symbol Ercc3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less