missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106734

Invitrogen™ Human XPA (aa 112-193) Control Fragment Recombinant Protein

Catalog No. RP106734
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106734 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106734 Supplier Invitrogen™ Supplier No. RP106734

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The XPA (xeroderma pigmentosumgroup A) protein specifically recognizes the UV-orchemically damaged DNA lesions, and triggers thenucleotide excision repair process. XPA binds to thereplication protein A (RPA) or the excision repaircross complementing 1 protein (ERCC 1). In the absence of nucleotide excision repair persisting (unrepaired) DNA lesions (adducts) may lead to the accumulation of gene mutations and ultimately to cancer. Xeroderma pigmentosum patients have a >2000 fold increased risk to develop skin cancer atsun-exposed areas.

Specifications

Accession Number P23025
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7507
Name Human XPA (aa 112-193) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI573865; DNA repair protein complementing XP-A cells; DNA repair protein complementing XP-A cells homolog; excision repair-controlling; mutant xeroderma pigmentosum complementation group A; xeroderma pigmentosum group A-complementing protein; Xeroderma pigmentosum group A-complementing protein homolog; xeroderma pigmentosum, complementation group A; XP1; XPA; XPA, DNA damage recognition and repair factor; Xpac
Common Name XPA
Gene Symbol XPA
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less