missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human WDR90 (aa 310-397) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107096
Description
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66421 (PA5-66421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for efficient primary cilium formation.Specifications
| Q96KV7 | |
| Blocking Assay, Control | |
| 197335 | |
| 100 μL | |
| C16orf15; C16orf16; C16orf17; C16orf18; C16orf19; KIAA1924; WD repeat domain 90; WD repeat-containing protein 90; WDR90 | |
| WDR90 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human WDR90 (aa 310-397) Control Fragment | |
| RUO | |
| WDR90 | |
| Unconjugated | |
| Recombinant | |
| GFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |