missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WDR8 (aa 312-430) Control Fragment Recombinant Protein

Catalog No. RP88840
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88840 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88840 Supplier Invitrogen™ Supplier No. RP88840

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55455 (PA5-55455. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Studies of the related mouse protein suggest that the encoded protein may play a role in the process of ossification.

Specifications

Accession Number Q9P2S5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 49856
Name Human WDR8 (aa 312-430) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610044M17Rik; 5330425N03Rik; Dd57; LOW QUALITY PROTEIN: WD repeat-containing protein WRAP73; WD repeat containing, antisense to TP73; WD repeat containing, antisense to Trp73; WD repeat domain 8; WD repeat-containing protein 8; WD repeat-containing protein 8; WD repeat-containing protein WRAP73; WD repeat-containing protein antisense to TP73; WD repeat-containing protein antisense to TP73 gene; WD repeat-containing protein WRAP73; WDR8; WRAP73
Common Name WDR8
Gene Symbol WRAP73
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less