missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104707

Invitrogen™ Human WBP11 (aa 102-194) Control Fragment Recombinant Protein

Catalog No. RP104707
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104707 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104707 Supplier Invitrogen™ Supplier No. RP104707

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111113 (PA5-111113. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Posttranslational modification of proteins by the addition of the small protein SUMO.

Specifications

Accession Number Q9Y2W2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51729
Name Human WBP11 (aa 102-194) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510026P17Rik; D6Wsu113e; DKFZp779M1063; hypothetical protein LOC402950; Npw38-binding protein; Npw38-binding protein NpwBP; NpwBP; PPP1R165; protein phosphatase 1, regulatory subunit 165; SH3 domain-binding protein; SH3 domain-binding protein SNP70; SIPP1; SNP70; Splicing factor that interacts with PQBP-1 and PP1; splicing factor, PQBP1 and PP1 interacting; Wbp11; WBP-11; WW domain binding protein 11; WW domain-binding protein 11; zgc:77390
Common Name WBP11
Gene Symbol WBP11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less