missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WASF3 (aa 203-302) Control Fragment Recombinant Protein

Catalog No. RP109101
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109101 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109101 Supplier Invitrogen™ Supplier No. RP109101

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WASP (for Wiskott-Aldrich syndrome protein) and N-WASP are downstream effectors of Cdc42 that are implicated in actin polymerization and cytoskeletal organization. The WASP family also includes VASP (vasodilator-stimulated phosphoprotein) and Mena (for mammalian enabled protein), which accumulate at focal adhesions and are also involved in the regulation of the actin cytoskeleton. The WAVE proteins are related to the WASP family proteins and are likewise involved in mediating actin reorganization downstream of the Rho family of small GTPases. The two protein homologs WAVE1 and WAVE2 specifically regulate membrane ruffling by inducing the formation of actin filament clusters in response to GTP binding and activating Rac. The WAVE proteins mediate this actin polymerization by cooperating with the Arp2/3 complex, a nucleation core, and thereby promoting the formation of actin filaments. WAVE1, which is also designated SCAR (for suppressor of cAR), is expressed primarily in the brain, while WAVE2 is widely expressed with the expression highest in peripheral blood leukocytes. WAVE3 forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

Specifications

Accession Number Q9UPY6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10810
Name Human WASF3 (aa 203-302) Control Fragment
Quantity 100 μL
Gene Alias Brush-1; KIAA0900; Protein WAVE-3; SCAR3; Verprolin homology domain-containing protein 3; WAS protein family member 3; WAS protein family, member 3; Wasf3; WASP family protein member 3; WASP family Verprolin-homologous protein 3; WAVE3; Wiskott-Aldrich syndrome protein family member 3
Common Name WASF3
Gene Symbol WASF3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less