missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106031

Invitrogen™ Human WAC (aa 539-622) Control Fragment Recombinant Protein

Catalog No. RP106031
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106031 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106031 Supplier Invitrogen™ Supplier No. RP106031
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65336 (PA5-65336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The WW domain containing adaptor with coiled-coil protein (WAC) contains a WW domain that mediates protein-protein interactions and colocalizes with RNA splicing factor SC35. Further studies have indicated that WAC is a functional partner of the RNF20/40 complex that ubiquitinates Histone H2B, and that WAC regulates H2B ubiquitination. WAC targets RNF20/40 to associate with RNA polymerase II complex for H2B ubiquitination at active transcription sites. WAC-dependent transcription is also important for cell-cycle checkpoint activation in response to genotoxic stress.

Specifications

Accession Number Q9BTA9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51322
Name Human WAC (aa 539-622) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110067P07Rik; A230035H12Rik; AI256735; AI256776; BM-016; DESSH; Kiaa1844; PRO1741; RGD1562407; Wac; WW domain containing adaptor with coiled-coil; WW domain-containing adapter protein with coiled-coil; WW domain-containing adaptor with coiled-coil; WW domain-containing protein 4; Wwp4
Common Name WAC
Gene Symbol Wac
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NATVVPQNSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less