missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88905

Invitrogen™ Human VRK1 (aa 5-141) Control Fragment Recombinant Protein

Catalog No. RP88905
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88905 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88905 Supplier Invitrogen™ Supplier No. RP88905

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81887. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human vaccinia-related kinase 1 (VRK1) is a new kinase related to a poxvirus kinase, and more distantly to the casein kinase 1 family. VRK1 shows strong autophosphorylating activity in several Ser and Thr residues. VRK has also been found to be an upstream regulator of p53 that belongs to a new signaling pathway.

Specifications

Accession Number Q99986
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7443
Name Human VRK1 (aa 5-141) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 51PK; MGC117401; MGC138280; PCH1; PCH1A; Serine/threonine-protein kinase 51PK; serine/threonine-protein kinase VRK1; vaccinia related kinase 1; vaccinia virus B1R-related kinase 1; vaccinia-related kinase 1; VRK1
Common Name VRK1
Gene Symbol VRK1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less