missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human VMO1 (aa 25-112) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93495
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54673 (PA5-54673. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
VMO1 (Vitelline Membrane Outer Layer 1 Homolog) is a Protein Coding gene.Specifications
| Q7Z5L0 | |
| Blocking Assay, Control | |
| 284013 | |
| 100 μL | |
| ERGA6350; ERGA6350 antibody; Gm741; MGC125880 antibody; MGC125881 antibody; PRO21055; PRO21055 antibody; RGD1559861; UNQ6350/PRO21055; vitelline membrane outer layer 1 homolog; vitelline membrane outer layer 1 homolog (chicken); vitelline membrane outer layer 1 homolog (chicken) antibody; vitelline membrane outer layer protein 1 homolog; vitelline membrane outer layer protein 1 homolog antibody; VMO1; VMO1 antibody | |
| Vmo1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human VMO1 (aa 25-112) Control Fragment | |
| RUO | |
| VMO1 | |
| Unconjugated | |
| Recombinant | |
| QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |